PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25294.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 237aa    MW: 25796.1 Da    PI: 6.8349
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25294.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-42611601100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q
  mrna25294.1-v1.0-hybrid  61 PCAACKILRRRCAEKCVLAPYFPPSEPAKFTIAHRVFGASNIIKFLQDLPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQ 146
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              ++ l+a+la++++e
  mrna25294.1-v1.0-hybrid 147 VSDLQAQLAKAQAE 160
                              *********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.03960161IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4361158IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MECSTDTSFN TPNSTTYAPS TPFSHHSSSS SRSSSPPITP TQTLTQAQTQ IPLPQNVVVS  60
PCAACKILRR RCAEKCVLAP YFPPSEPAKF TIAHRVFGAS NIIKFLQDLP ESQRADAVSS  120
MVYEASARIR DPVYGCAGAI CHLQKQVSDL QAQLAKAQAE VVNMQCQQAN LVALLMEMAK  180
PDHHGQGSPD QQPLDHHNFI TSSPLPHSNI LNQTNLSFLD DHNSALGSFW ELPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294671.11e-176PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0706e-95M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA12G07650.18e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-76LOB domain-containing protein 1